Chromodomain of hp1 complexed with histone h3 tail containing monomethyllysine 9.
PDB DOI: 10.2210/pdb1q3l/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2003-07-30 Deposition Author(s): Jacobs, S.A. , Khorasanizadeh, S.
Chromodomain of hp1 complexed with histone h3 tail containing monomethyllysine 9.
Jacobs, S.A. , Khorasanizadeh, S.
Primary Citation of Related Structures: 1Q3L
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Heterochromatin protein 1 | A | 69 | Drosophila Melanogaster , Synthetic Construct | MKKHHHHHHAEEEEEEYAVEKIIDRRVRKGMVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKD |
Histone H3 | P | 16 | Drosophila Melanogaster , Synthetic Construct | ARTKQTARKSTGGKAY |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-07-30 Deposition Author(s): Jacobs, S.A. , Khorasanizadeh, S.