Solution nmr structure of protein nma1147 from neisseria meningitidis. northeast structural genomics consortium target mr19
PDB DOI: 10.2210/pdb1puz/pdb
Classification: structural genomics, unknown function Organism(s): Influenza A Virus (A/American Green-Winged Teal/Washington/195750/2014(H5N1))
Deposited: 2003-06-25 Deposition Author(s): Acton, T. , Chiang, Y. , Liu, G. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Sukumaran, D.K. , Szyperski, T. , Xu, D.
Solution nmr structure of protein nma1147 from neisseria meningitidis. northeast structural genomics consortium target mr19
Acton, T. , Chiang, Y. , Liu, G. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Sukumaran, D.K. , Szyperski, T. , Xu, D.
Primary Citation of Related Structures: 1PUZ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
conserved hypothetical protein | A | 82 | Influenza A Virus (A/American Green-Winged Teal/Washington/195750/2014(H5N1)) | MMVFDDIAKRKIRFQTRRGLLELDLIFGRFMEKEFEHLSDKELSEFSEILEFQDQELLALINGHSETDKGHLIPMLEKIRRA |
Method: SOLUTION NMR
Deposited Date: 2003-06-25 Deposition Author(s): Acton, T. , Chiang, Y. , Liu, G. , Montelione, G.T. , Northeast Structural Genomics Consortium (Nesg) , Sukumaran, D.K. , Szyperski, T. , Xu, D.