Solution structure of the mutt pyrophosphohydrolase complexed with mg(2+) and 8-oxo-dgmp, a tightly-bound product
PDB DOI: 10.2210/pdb1pun/pdb
Classification: HYDROLASE Organism(s): Escherichia Coli
Deposited: 2003-06-25 Deposition Author(s): Azurmendi, H.F. , Massiah, M.A. , Mildvan, A.S. , Saraswat, V.
Solution structure of the mutt pyrophosphohydrolase complexed with mg(2+) and 8-oxo-dgmp, a tightly-bound product
Azurmendi, H.F. , Massiah, M.A. , Mildvan, A.S. , Saraswat, V.
Primary Citation of Related Structures: 1PUN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Mutator mutT protein | A | 129 | Escherichia Coli | MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL |
Method: SOLUTION NMR
Deposited Date: 2003-06-25 Deposition Author(s): Azurmendi, H.F. , Massiah, M.A. , Mildvan, A.S. , Saraswat, V.