The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
PDB DOI: 10.2210/pdb1psf/pdb
Classification: PHOTOSYSTEM I Organism(s): Synechococcus Sp.
Deposited: 1994-04-13 Deposition Author(s): Bryant, D.A. , Falzone, C.J. , Kao, Y.-H. , Lecomte, J.T.J. , Zhao, J.
The three-dimensional solution structure of psae from the cyanobacterium synechococcus sp. strain pcc 7002: a photosystem i protein that shows structural homology with sh3 domains
Bryant, D.A. , Falzone, C.J. , Kao, Y.-H. , Lecomte, J.T.J. , Zhao, J.
Primary Citation of Related Structures: 1PSF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PHOTOSYSTEM I ACCESSORY PROTEIN E | A | 69 | Synechococcus Sp. | AIERGSKVKILRKESYWYGDVGTVASIDKSGIIYPVIVRFNKVNYNGFSGSAGGLNTNNFAEHELEVVG |
Method: SOLUTION NMR
Deposited Date: 1994-04-13 Deposition Author(s): Bryant, D.A. , Falzone, C.J. , Kao, Y.-H. , Lecomte, J.T.J. , Zhao, J.