Structure of the channel-forming trans-membrane domain of virus protein ""u""(vpu) from hiv-1
PDB DOI: 10.2210/pdb1pje/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2003-06-02 Deposition Author(s): Mesleh, M.F. , Montal, M. , Mrse, A.A. , Nevzorov, A.A. , Oblatt-Montal, M. , Opella, S.J. , Park, S.H.
Structure of the channel-forming trans-membrane domain of virus protein ""u""(vpu) from hiv-1
Mesleh, M.F. , Montal, M. , Mrse, A.A. , Nevzorov, A.A. , Oblatt-Montal, M. , Opella, S.J. , Park, S.H.
Primary Citation of Related Structures: 1PJE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| VPU protein | A | 36 | Human Immunodeficiency Virus 1 | MQPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK |
Method: SOLID-STATE NMR
Deposited Date: 2003-06-02 Deposition Author(s): Mesleh, M.F. , Montal, M. , Mrse, A.A. , Nevzorov, A.A. , Oblatt-Montal, M. , Opella, S.J. , Park, S.H.