Structure of the channel-forming trans-membrane domain of virus protein ""u"" (vpu) from hiv-1
PDB DOI: 10.2210/pdb1pi7/pdb
Classification: VIRAL PROTEIN Organism(s): Human Immunodeficiency Virus 1
Deposited: 2003-05-29 Deposition Author(s): Mesleh, M.F. , Montal, M. , Mrse, A.A. , Nevzorov, A.A. , Oblatt-Montal, M. , Opella, S.J. , Park, S.H.
Structure of the channel-forming trans-membrane domain of virus protein ""u"" (vpu) from hiv-1
Mesleh, M.F. , Montal, M. , Mrse, A.A. , Nevzorov, A.A. , Oblatt-Montal, M. , Opella, S.J. , Park, S.H.
Primary Citation of Related Structures: 1PI7
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
VPU protein | A | 36 | Human Immunodeficiency Virus 1 | MQPIQIAIVALVVAIIIAIVVWSIVIIEGRGGKKKK |
Method: SOLID-STATE NMR
Deposited Date: 2003-05-29 Deposition Author(s): Mesleh, M.F. , Montal, M. , Mrse, A.A. , Nevzorov, A.A. , Oblatt-Montal, M. , Opella, S.J. , Park, S.H.