Crystal structure of the response regulator spo0f complexed with mn2+
PDB DOI: 10.2210/pdb1pey/pdb
Classification: TRANSFERASE Organism(s): Bacillus Subtilis
Deposited: 2003-05-22 Deposition Author(s): Mukhopadhyay, D. , Sen, U. , Varughese, K.I. , Zapf, J.
Crystal structure of the response regulator spo0f complexed with mn2+
Mukhopadhyay, D. , Sen, U. , Varughese, K.I. , Zapf, J.
Primary Citation of Related Structures: 1PEY
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sporulation initiation phosphotransferase F | A | 124 | Bacillus Subtilis | MMNEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN |
| Sporulation initiation phosphotransferase F | B | 124 | Bacillus Subtilis | MMNEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN |
| Sporulation initiation phosphotransferase F | C | 124 | Bacillus Subtilis | MMNEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-05-22 Deposition Author(s): Mukhopadhyay, D. , Sen, U. , Varughese, K.I. , Zapf, J.