Nmr structure of a prototype lnr module from human notch1
PDB DOI: 10.2210/pdb1pb5/pdb
Classification: SIGNALING PROTEIN Organism(s): Homo Sapiens
Deposited: 2003-05-14 Deposition Author(s): Aster, J.C. , Blacklow, S.C. , North, C.L. , Sanchez-Irizarry, C. , Vardar, D.
Nmr structure of a prototype lnr module from human notch1
Aster, J.C. , Blacklow, S.C. , North, C.L. , Sanchez-Irizarry, C. , Vardar, D.
Primary Citation of Related Structures: 1PB5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Neurogenic locus notch homolog protein 1 | A | 35 | Homo Sapiens | EEACELPECQEDAGNKVCSLQCNNHACGWDGGDCS |
Method: SOLUTION NMR
Deposited Date: 2003-05-14 Deposition Author(s): Aster, J.C. , Blacklow, S.C. , North, C.L. , Sanchez-Irizarry, C. , Vardar, D.