Solution structure and dynamics of the egf/tgf-alpha chimera t1e
PDB DOI: 10.2210/pdb1p9j/pdb
Classification: HORMONE/GROWTH FACTOR Organism(s): Homo Sapiens
Deposited: 2003-05-12 Deposition Author(s): Stortelers, C. , Van Ingen, H. , Van Leeuwen, J.E. , Van Zoelen, E.J. , Vuister, G.W. , Walma, T. , Wingens, M.
Solution structure and dynamics of the egf/tgf-alpha chimera t1e
Stortelers, C. , Van Ingen, H. , Van Leeuwen, J.E. , Van Zoelen, E.J. , Vuister, G.W. , Walma, T. , Wingens, M.
Primary Citation of Related Structures: 1P9J
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| chimera of Epidermal growth factor(EGF) and Transforming growth factor alpha (TGF-alpha) | A | 54 | Homo Sapiens | VVSHFNDCPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWEL |
Method: SOLUTION NMR
Deposited Date: 2003-05-12 Deposition Author(s): Stortelers, C. , Van Ingen, H. , Van Leeuwen, J.E. , Van Zoelen, E.J. , Vuister, G.W. , Walma, T. , Wingens, M.