Nmr structure of parg symmetric dimer
PDB DOI: 10.2210/pdb1p94/pdb
Classification: CELL CYCLE Organism(s): Salmonella Enterica
Deposited: 2003-05-09 Deposition Author(s): Barilla, D. , Golovanov, A.P. , Golovanova, M. , Hayes, F. , Lian, L.Y.
Nmr structure of parg symmetric dimer
Barilla, D. , Golovanov, A.P. , Golovanova, M. , Hayes, F. , Lian, L.Y.
Primary Citation of Related Structures: 1P94
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| plasmid partition protein ParG | A | 76 | Salmonella Enterica | MSLEKAHTSVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNWLKENE |
| plasmid partition protein ParG | B | 76 | Salmonella Enterica | MSLEKAHTSVKKMTFGENRDLERVVTAPVSSGKIKRVNVNFDEEKHTRFKAACARKGTSITDVVNQLVDNWLKENE |
Method: SOLUTION NMR
Deposited Date: 2003-05-09 Deposition Author(s): Barilla, D. , Golovanov, A.P. , Golovanova, M. , Hayes, F. , Lian, L.Y.