Crystal structure of engrailed homeodomain mutant k52a
PDB DOI: 10.2210/pdb1p7i/pdb
Classification: DNA BINDING PROTEIN Organism(s): Drosophila Melanogaster
Deposited: 2003-05-02 Deposition Author(s): Federici, L. , Fersht, A.R. , Freund, S.M. , Lovell, S.C. , Luisi, B.F. , Mayor, U. , Stollar, E.J.
Method: X-RAY DIFFRACTION Resolution: 2.1 Å
Crystal structure of engrailed homeodomain mutant k52a
Federici, L. , Fersht, A.R. , Freund, S.M. , Lovell, S.C. , Luisi, B.F. , Mayor, U. , Stollar, E.J.
Primary Citation of Related Structures: 1P7I
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Segmentation polarity homeobox protein engrailed | A | 59 | Drosophila Melanogaster | EKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNARAKIKKS |
| Segmentation polarity homeobox protein engrailed | B | 59 | Drosophila Melanogaster | EKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNARAKIKKS |
| Segmentation polarity homeobox protein engrailed | C | 59 | Drosophila Melanogaster | EKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNARAKIKKS |
| Segmentation polarity homeobox protein engrailed | D | 59 | Drosophila Melanogaster | EKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNARAKIKKS |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-05-02 Deposition Author(s): Federici, L. , Fersht, A.R. , Freund, S.M. , Lovell, S.C. , Luisi, B.F. , Mayor, U. , Stollar, E.J.