Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
PDB DOI: 10.2210/pdb1p7e/pdb
Classification: IMMUNE SYSTEM Organism(s): Streptococcus Sp. 'Group G'
Deposited: 2003-05-01 Deposition Author(s): Bax, A. , Delaglio, F. , Ramirez, B.E. , Ulmer, T.S.
Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Bax, A. , Delaglio, F. , Ramirez, B.E. , Ulmer, T.S.
Primary Citation of Related Structures: 1P7E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Immunoglobulin G binding protein G | A | 56 | Streptococcus Sp. 'Group G' | MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE |
Method: SOLUTION NMR
Deposited Date: 2003-05-01 Deposition Author(s): Bax, A. , Delaglio, F. , Ramirez, B.E. , Ulmer, T.S.