Crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form i)
PDB DOI: 10.2210/pdb1ovu/pdb
Classification: DE NOVO PROTEIN Organism(s): N.A.
Deposited: 2003-03-27 Deposition Author(s): Di Costanzo, L. , Geremia, S.
Method: X-RAY DIFFRACTION Resolution: 3.1 Å
Crystal structure of four-helix bundle model di-co(ii)-df1-l13a (form i)
Primary Citation of Related Structures: 1OVU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
four-helix bundle model di-Co(II)-DF1-L13A (form I) | A | 50 | N.A. | XDYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILGX |
four-helix bundle model di-Co(II)-DF1-L13A (form I) | B | 50 | N.A. | XDYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILGX |
four-helix bundle model di-Co(II)-DF1-L13A (form I) | C | 50 | N.A. | XDYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILGX |
four-helix bundle model di-Co(II)-DF1-L13A (form I) | D | 50 | N.A. | XDYLRELLKLELQAIKQYREALEYVKLPVLAKILEDEEKHIEWLETILGX |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-03-27 Deposition Author(s): Di Costanzo, L. , Geremia, S.