Structure of the ca2+/c-terminal domain of caltractin in complex with the cdc31p-binding domain from kar1p
PDB DOI: 10.2210/pdb1oqp/pdb
Classification: PROTEIN BINDING Organism(s): Cupriavidus Necator H16 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-03-10 Deposition Author(s): Chazin, W.J. , Hu, H.T.
Structure of the ca2+/c-terminal domain of caltractin in complex with the cdc31p-binding domain from kar1p
Primary Citation of Related Structures: 1OQP
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Caltractin | A | 77 | Cupriavidus Necator H16 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSGERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGENLTEEELQEMIAEADRNDDNEIDEDEFIRIMKKTSLF |
Cell division control protein KAR1 | B | 19 | Cupriavidus Necator H16 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KKRELIESKWHRLLFHDKK |
Method: SOLUTION NMR
Deposited Date: 2003-03-10 Deposition Author(s): Chazin, W.J. , Hu, H.T.