Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein at 1.39 a resolution
PDB DOI: 10.2210/pdb1oot/pdb
Classification: STRUCTURAL GENOMICS Organism(s): Saccharomyces Cerevisiae
Deposited: 2003-03-04 Deposition Author(s): Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M.
Method: X-RAY DIFFRACTION Resolution: 1.39 Å
Crystal structure of the sh3 domain from a s. cerevisiae hypothetical 40.4 kda protein at 1.39 a resolution
Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M.
Primary Citation of Related Structures: 1OOT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hypothetical 40.4 kDa protein in PES4-HIS2 intergenic region | A | 60 | Saccharomyces Cerevisiae | GSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVELV |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-03-04 Deposition Author(s): Kursula, P. , Lehmann, F. , Song, Y.H. , Wilmanns, M.