Crystal structure of src sh2 domain bound to doubly phosphorylated peptide pqpyepyipi
PDB DOI: 10.2210/pdb1nzl/pdb
Classification: TRANSFERASE Organism(s): Marichromatium Purpuratum 984 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2003-02-18 Deposition Author(s): Lubman, O.Y. , Waksman, G.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of src sh2 domain bound to doubly phosphorylated peptide pqpyepyipi
Primary Citation of Related Structures: 1NZL
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Tyrosine-protein kinase transforming protein SRC | A | 103 | Marichromatium Purpuratum 984 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT |
Tyrosine-protein kinase transforming protein SRC | B | 103 | Marichromatium Purpuratum 984 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT |
Doubly phosphorylated peptide ligand (PQpYEpYIPI) | C | 8 | Marichromatium Purpuratum 984 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PQYEYIPA |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-02-18 Deposition Author(s): Lubman, O.Y. , Waksman, G.