Crystal structure of src sh2 domain bound to doubly phosphorylated peptide pqpyepyipi
PDB DOI: 10.2210/pdb1nzl/pdb
Classification: TRANSFERASE Organism(s): Rous Sarcoma Virus (Strain Schmidt-Ruppin) , Synthetic Construct
Deposited: 2003-02-18 Deposition Author(s): Lubman, O.Y. , Waksman, G.
Method: X-RAY DIFFRACTION Resolution: 1.9 Å
Crystal structure of src sh2 domain bound to doubly phosphorylated peptide pqpyepyipi
Primary Citation of Related Structures: 1NZL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tyrosine-protein kinase transforming protein SRC | A | 103 | Rous Sarcoma Virus (Strain Schmidt-Ruppin) , Synthetic Construct | AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT |
| Tyrosine-protein kinase transforming protein SRC | B | 103 | Rous Sarcoma Virus (Strain Schmidt-Ruppin) , Synthetic Construct | AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT |
| Doubly phosphorylated peptide ligand (PQpYEpYIPI) | C | 8 | Rous Sarcoma Virus (Strain Schmidt-Ruppin) , Synthetic Construct | PQYEYIPA |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-02-18 Deposition Author(s): Lubman, O.Y. , Waksman, G.