Solution structure of herg specific scorpion toxin cnerg1
PDB DOI: 10.2210/pdb1ne5/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2002-12-10 Deposition Author(s): Alewood, P. , Kuchel, P.W. , Paramjit, B. , Torres, A.M. , Vandenberg, J.I.
Solution structure of herg specific scorpion toxin cnerg1
Alewood, P. , Kuchel, P.W. , Paramjit, B. , Torres, A.M. , Vandenberg, J.I.
Primary Citation of Related Structures: 1NE5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ergtoxin | A | 42 | N.A. | DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA |
Method: SOLUTION NMR
Deposited Date: 2002-12-10 Deposition Author(s): Alewood, P. , Kuchel, P.W. , Paramjit, B. , Torres, A.M. , Vandenberg, J.I.