Solution nmr structure of phospholamban in detergent micelles
PDB DOI: 10.2210/pdb1n7l/pdb
Classification: SIGNALING PROTEIN Organism(s): Oryctolagus Cuniculus
Deposited: 2002-11-15 Deposition Author(s): Mascioni, A. , Thomas, D.D. , Veglia, G. , Zamoon, J.
Solution nmr structure of phospholamban in detergent micelles
Mascioni, A. , Thomas, D.D. , Veglia, G. , Zamoon, J.
Primary Citation of Related Structures: 1N7L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cardiac phospholamban | A | 53 | Oryctolagus Cuniculus | AMEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFALILIFLLLIAIIVMLL |
Method: SOLUTION NMR
Deposited Date: 2002-11-15 Deposition Author(s): Mascioni, A. , Thomas, D.D. , Veglia, G. , Zamoon, J.