Structure of myoglobin mb-yqr 316 ns after photolysis of carbon monoxide solved from laue data at rt.
PDB DOI: 10.2210/pdb1mz0/pdb
Classification: OXYGEN STORAGE/TRANSPORT Organism(s): Physeter Catodon
Deposited: 2002-10-04 Deposition Author(s): Anfinrud, P. , Arcovito, A. , Bourgeois, D. , Brunori, M. , Miele, A.E. , Schotte, F. , Sciara, G. , Vallone, B. , Wulff, M.
Structure of myoglobin mb-yqr 316 ns after photolysis of carbon monoxide solved from laue data at rt.
Anfinrud, P. , Arcovito, A. , Bourgeois, D. , Brunori, M. , Miele, A.E. , Schotte, F. , Sciara, G. , Vallone, B. , Wulff, M.
Primary Citation of Related Structures: 1MZ0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Myoglobin | A | 154 | Physeter Catodon | MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELGYQG |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-10-04 Deposition Author(s): Anfinrud, P. , Arcovito, A. , Bourgeois, D. , Brunori, M. , Miele, A.E. , Schotte, F. , Sciara, G. , Vallone, B. , Wulff, M.