Solution structure of the n-terminal domain of znta in the zn(ii)-form
PDB DOI: 10.2210/pdb1mwz/pdb
Classification: HYDROLASE Organism(s): Escherichia Coli
Deposited: 2002-10-01 Deposition Author(s): Banci, L. , Bertini, I. , Ciofi-Baffoni, S. , Finney, L.A. , O'Halloran, T.V. , Outten, C.E.
Solution structure of the n-terminal domain of znta in the zn(ii)-form
Banci, L. , Bertini, I. , Ciofi-Baffoni, S. , Finney, L.A. , O'Halloran, T.V. , Outten, C.E.
Primary Citation of Related Structures: 1MWZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ZntA | A | 73 | Escherichia Coli | SGTRYSWKVSGMDCAACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGYSLRDEQAAE |
Method: SOLUTION NMR
Deposited Date: 2002-10-01 Deposition Author(s): Banci, L. , Bertini, I. , Ciofi-Baffoni, S. , Finney, L.A. , O'Halloran, T.V. , Outten, C.E.