1MWN
Solution nmr structure of s100b bound to the high-affinity target peptide trtk-12
PDB DOI: 10.2210/pdb1mwn/pdb
Classification: STRUCTURAL PROTEIN Organism(s): Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-09-30 Deposition Author(s): Baldisseri, D.M. , Inman, K.G. , Miller, K.E. , Rustandi, R.R. , Weber, D.J. , Yang, R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of s100b bound to the high-affinity target peptide trtk-12
Baldisseri, D.M. , Inman, K.G. , Miller, K.E. , Rustandi, R.R. , Weber, D.J. , Yang, R.
Primary Citation of Related Structures: 1MWN
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| S-100 protein, beta chain | A | 92 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE |
| S-100 protein, beta chain | B | 92 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE |
| F-actin capping protein alpha-1 subunit | X | 12 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TRTKIDWNKILS |
| F-actin capping protein alpha-1 subunit | Y | 12 | Pandinus Imperator , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | TRTKIDWNKILS |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2002-09-30 Deposition Author(s): Baldisseri, D.M. , Inman, K.G. , Miller, K.E. , Rustandi, R.R. , Weber, D.J. , Yang, R.