Cue domain of yeast vps9p
PDB DOI: 10.2210/pdb1mn3/pdb
Classification: PROTEIN TRANSPORT Organism(s): Saccharomyces Cerevisiae
Deposited: 2002-09-04 Deposition Author(s): Davies, B.A. , Ghirlando, R. , Horazdovsky, B.F. , Hurley, J.H. , Jones, E. , Misra, S. , Prag, G.
Cue domain of yeast vps9p
Davies, B.A. , Ghirlando, R. , Horazdovsky, B.F. , Hurley, J.H. , Jones, E. , Misra, S. , Prag, G.
Primary Citation of Related Structures: 1MN3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Vacuolar protein sorting-associated protein VPS9 | A | 54 | Saccharomyces Cerevisiae | SSLIKKIEENERKDTLNTLQNMFPDMDPSLIEDVCIAKKSRIEPCVDALLSLSE |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-09-04 Deposition Author(s): Davies, B.A. , Ghirlando, R. , Horazdovsky, B.F. , Hurley, J.H. , Jones, E. , Misra, S. , Prag, G.