1MFG
The structure of erbin pdz domain bound to the carboxy-terminal tail of the erbb2 receptor
PDB DOI: 10.2210/pdb1mfg/pdb
Classification: SIGNALING PROTEIN Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-08-10 Deposition Author(s): Birrane, G. , Chung, J. , Ladias, J.A.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 1.25 Å
The structure of erbin pdz domain bound to the carboxy-terminal tail of the erbb2 receptor
Birrane, G. , Chung, J. , Ladias, J.A.
Primary Citation of Related Structures: 1MFG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Erb-B2 INTERACTING PROTEIN | A | 95 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQNTVELIIVREVSS |
| Erb-B2 carboxyl-terminal fragment | B | 9 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EYLGLDVPV |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2002-08-10 Deposition Author(s): Birrane, G. , Chung, J. , Ladias, J.A.