1M7L
Solution structure of the coiled-coil trimerization domain from lung surfactant protein d
PDB DOI: 10.2210/pdb1m7l/pdb
Classification: SUGAR BINDING PROTEIN Organism(s): Homo Sapiens
Deposited: 2002-07-22 Deposition Author(s): Campbell, I.D. , Comfort, D. , Hoppe, H.-J. , Kovacs, H. , Nilges, M. , O'Donoghue, S.I. , Reid, K.B.M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the coiled-coil trimerization domain from lung surfactant protein d
Campbell, I.D. , Comfort, D. , Hoppe, H.-J. , Kovacs, H. , Nilges, M. , O'Donoghue, S.I. , Reid, K.B.M.
Primary Citation of Related Structures: 1M7L
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Pulmonary surfactant-associated protein D | A | 40 | Homo Sapiens | GLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGGI |
| Pulmonary surfactant-associated protein D | B | 40 | Homo Sapiens | GLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGGI |
| Pulmonary surfactant-associated protein D | C | 40 | Homo Sapiens | GLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGGI |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2002-07-22 Deposition Author(s): Campbell, I.D. , Comfort, D. , Hoppe, H.-J. , Kovacs, H. , Nilges, M. , O'Donoghue, S.I. , Reid, K.B.M.