Estrogen related receptor 2 dna binding domain in complex with dna
PDB DOI: 10.2210/pdb1lo1/pdb
Classification: HORMONE/GROWTH FACTOR RECEPTOR/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-05-05 Deposition Author(s): Dyson, H.J. , Evans, R.M. , Gearhart, M.D. , Holmbeck, S.M.A. , Wright, P.E.
Method: SOLUTION NMR Resolution: N.A.
Estrogen related receptor 2 dna binding domain in complex with dna
Dyson, H.J. , Evans, R.M. , Gearhart, M.D. , Holmbeck, S.M.A. , Wright, P.E.
Primary Citation of Related Structures: 1LO1
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Steroid hormone receptor ERR2 | A | 98 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | AIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYKRRLDSENS |
Method: SOLUTION NMR
Deposited Date: 2002-05-05 Deposition Author(s): Dyson, H.J. , Evans, R.M. , Gearhart, M.D. , Holmbeck, S.M.A. , Wright, P.E.