Solution structure of psmalmotoxin 1, the first characterized specific blocker of asic1a na+ channel
PDB DOI: 10.2210/pdb1lmm/pdb
Classification: TOXIN Organism(s): [Scytonema Hofmanni] Utex 2349
Deposited: 2002-05-02 Deposition Author(s): Bernard, C. , Darbon, H. , Escoubas, P. , Lazdunski, M.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of psmalmotoxin 1, the first characterized specific blocker of asic1a na+ channel
Bernard, C. , Darbon, H. , Escoubas, P. , Lazdunski, M.
Primary Citation of Related Structures: 1LMM
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Psalmotoxin 1 | A | 40 | [Scytonema Hofmanni] Utex 2349 | EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT |
Method: SOLUTION NMR
Deposited Date: 2002-05-02 Deposition Author(s): Bernard, C. , Darbon, H. , Escoubas, P. , Lazdunski, M.