1LJZ
Nmr structure of an achr-peptide (torpedo californica, alpha-subunit residues 182-202) in complex with alpha-bungarotoxin
PDB DOI: 10.2210/pdb1ljz/pdb
Classification: Receptor, Toxin Organism(s): Rice Stripe Tenuivirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-04-23 Deposition Author(s): Anglister, J. , Chill, J.H. , Eisenstein, M. , Samson, A.O. , Scherf, T.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of an achr-peptide (torpedo californica, alpha-subunit residues 182-202) in complex with alpha-bungarotoxin
Anglister, J. , Chill, J.H. , Eisenstein, M. , Samson, A.O. , Scherf, T.
Primary Citation of Related Structures: 1LJZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| alpha-Bungarotoxin | A | 74 | Rice Stripe Tenuivirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG |
| Acetylcholine receptor protein | B | 25 | Rice Stripe Tenuivirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | EERGWKHWVYYTCCPDTPYLDITEE |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2002-04-23 Deposition Author(s): Anglister, J. , Chill, J.H. , Eisenstein, M. , Samson, A.O. , Scherf, T.