Solution structure of the docking and dimerization domain of protein kinase a ii-alpha (riialpha d/d). alternatively called the n-terminal dimerization domain of the regulatory subunit of protein kinase a.
PDB DOI: 10.2210/pdb1l6e/pdb
Classification: TRANSFERASE Organism(s): Mus Musculus
Deposited: 2002-03-08 Deposition Author(s): Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the docking and dimerization domain of protein kinase a ii-alpha (riialpha d/d). alternatively called the n-terminal dimerization domain of the regulatory subunit of protein kinase a.
Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.
Primary Citation of Related Structures: 1L6E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| cAMP-dependent protein kinase Type II-alpha regulatory chain | A | 46 | Mus Musculus | HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
| cAMP-dependent protein kinase Type II-alpha regulatory chain | B | 46 | Mus Musculus | HMGHIQIPPGLTELLQGYTVEVLRQQPPDLVDFAVEYFTRLREARR |
Method: SOLUTION NMR
Deposited Date: 2002-03-08 Deposition Author(s): Jennings, P.A. , Morikis, D. , Newlon, M.G. , Roy, M. , Scott, J.D.