Solution structure of the cdc13 dna-binding domain in a complex with single-stranded telomeric dna (dna structure not modeled)
PDB DOI: 10.2210/pdb1kxl/pdb
Classification: CELL CYCLE Organism(s): Saccharomyces Cerevisiae
Deposited: 2002-01-31 Deposition Author(s): Anderson, E.M. , Mitton-Fry, R.M. , Wuttke, D.S.
Solution structure of the cdc13 dna-binding domain in a complex with single-stranded telomeric dna (dna structure not modeled)
Anderson, E.M. , Mitton-Fry, R.M. , Wuttke, D.S.
Primary Citation of Related Structures: 1KXL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| CELL DIVISION CONTROL PROTEIN 13 | A | 199 | Saccharomyces Cerevisiae | MRMSKMARKDPTIEFCQLGLDTFETKYITMFGMLVSCSFDKPAFISFVFSDFTKNDIVQNYLYDRYLIDYENKLELNEGFKAIMYKNQFETFDSKLRKIFNNGLRDLQNGRDENLSQYGIVCKMNIKVKMYNGKLNAIVRECEPVPHSQISSIASPSQCEHLRLFYQRAFKRIGESAISRYFEEYRRFFPIHRNGSHLA |
Method: SOLUTION NMR
Deposited Date: 2002-01-31 Deposition Author(s): Anderson, E.M. , Mitton-Fry, R.M. , Wuttke, D.S.