The 1.6 angstroms structure of the kunitz-type domain from the alpha3 chain of the human type vi collagen
PDB DOI: 10.2210/pdb1knt/pdb
Classification: COLLAGEN TYPE VI FRAGMENT Organism(s): Homo Sapiens
Deposited: 1994-08-18 Deposition Author(s): Arnoux, B. , Bjorn, S. , Ducruix, A. , Merigeau, K. , Norris, F. , Norris, K. , Olsen, O. , Petersen, L. , Saludjian, P.
The 1.6 angstroms structure of the kunitz-type domain from the alpha3 chain of the human type vi collagen
Arnoux, B. , Bjorn, S. , Ducruix, A. , Merigeau, K. , Norris, F. , Norris, K. , Olsen, O. , Petersen, L. , Saludjian, P.
Primary Citation of Related Structures: 1KNT
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| COLLAGEN TYPE VI | A | 58 | Homo Sapiens | ETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCAPV |
Method: X-RAY DIFFRACTION
Deposited Date: 1994-08-18 Deposition Author(s): Arnoux, B. , Bjorn, S. , Ducruix, A. , Merigeau, K. , Norris, F. , Norris, K. , Olsen, O. , Petersen, L. , Saludjian, P.