North-atlantic ocean pout antifreeze protein type iii isoform hplc12 mutant, nmr, minimized average structure
PDB DOI: 10.2210/pdb1kdf/pdb
Classification: ANTIFREEZE PROTEIN Organism(s): Macrozoarces Americanus
Deposited: 1996-07-08 Deposition Author(s): Davies, P.L. , Deluca, C.I. , Sonnichsen, F.D. , Sykes, B.D.
Method: SOLUTION NMR Resolution: N.A.
North-atlantic ocean pout antifreeze protein type iii isoform hplc12 mutant, nmr, minimized average structure
Davies, P.L. , Deluca, C.I. , Sonnichsen, F.D. , Sykes, B.D.
Primary Citation of Related Structures: 1KDF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ANTIFREEZE PROTEIN | A | 70 | Macrozoarces Americanus | MNQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVKGYAAKDEL |
Method: SOLUTION NMR
Deposited Date: 1996-07-08 Deposition Author(s): Davies, P.L. , Deluca, C.I. , Sonnichsen, F.D. , Sykes, B.D.