Even-skipped homeodomain complexed to at-rich dna
PDB DOI: 10.2210/pdb1jgg/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Drosophila Melanogaster , Synthetic Construct
Deposited: 2001-06-25 Deposition Author(s): Aggarwal, A.K. , Hirsch, J.A.
Even-skipped homeodomain complexed to at-rich dna
Primary Citation of Related Structures: 1JGG
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Segmentation Protein Even-Skipped | A | 60 | Drosophila Melanogaster , Synthetic Construct | VRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQR |
Segmentation Protein Even-Skipped | B | 60 | Drosophila Melanogaster , Synthetic Construct | VRRYRTAFTRDQLGRLEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKRQR |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-06-25 Deposition Author(s): Aggarwal, A.K. , Hirsch, J.A.