Crystal structure of the dna-binding domain zalpha of dlm-1 bound to z-dna
PDB DOI: 10.2210/pdb1j75/pdb
Classification: IMMUNE SYSTEM/DNA Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2001-05-15 Deposition Author(s): Behlke, J. , Heinemann, U. , Lowenhaupt, K. , Rich, A. , Schwartz, T.
Crystal structure of the dna-binding domain zalpha of dlm-1 bound to z-dna
Behlke, J. , Heinemann, U. , Lowenhaupt, K. , Rich, A. , Schwartz, T.
Primary Citation of Related Structures: 1J75
| Nucleic Acids / Hybrid | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| 5'-D(*TP*CP*GP*CP*GP*CP*G)-3' | b | 7 | NA | TCGCGCG |
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tumor Stroma and Activated Macrophage Protein DLM-1 | A | 67 | Mus Musculus , Synthetic Construct | GSHMLSTGDNLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPEPATWSIGG |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-05-15 Deposition Author(s): Behlke, J. , Heinemann, U. , Lowenhaupt, K. , Rich, A. , Schwartz, T.