Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
PDB DOI: 10.2210/pdb1j6t/pdb
Classification: TRANSFERASE Organism(s): Escherichia Coli
Deposited: 2002-08-14 Deposition Author(s): Clore, G.M. , Cornilescu, G.
Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
Primary Citation of Related Structures: 1J6T
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PTS SYSTEM, MANNITOL-SPECIFIC IIABC COMPONENT | A | 148 | Escherichia Coli | MANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAHTTSVDEVLELLAGRK |
| Phosphocarrier protein HPr | B | 85 | Escherichia Coli | MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTVVTISAEGEDEQKAVEHLVKLMAELE |
Method: SOLUTION NMR
Deposited Date: 2002-08-14 Deposition Author(s): Clore, G.M. , Cornilescu, G.