Solution structure of the non-sequence-specific hmgb protein nhp6a in complex with sry dna
PDB DOI: 10.2210/pdb1j5n/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2002-05-15 Deposition Author(s): Allain, F.H.-T. , Feigon, J. , Johnson, R.C. , Masse, J.E. , Wong, B. , Yen, Y.-M.
Solution structure of the non-sequence-specific hmgb protein nhp6a in complex with sry dna
Allain, F.H.-T. , Feigon, J. , Johnson, R.C. , Masse, J.E. , Wong, B. , Yen, Y.-M.
Primary Citation of Related Structures: 1J5N
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Nonhistone chromosomal protein 6A | A | 93 | Grouper Iridovirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNATLA |
Method: SOLUTION NMR
Deposited Date: 2002-05-15 Deposition Author(s): Allain, F.H.-T. , Feigon, J. , Johnson, R.C. , Masse, J.E. , Wong, B. , Yen, Y.-M.