Proposed amino acid sequence and the 1.63 angstrom x-ray crystal structure of a plant cysteine protease ervatamin b: insight into the structural basis of its stability and substrate specificity.
PDB DOI: 10.2210/pdb1iwd/pdb
Classification: HYDROLASE Organism(s): Tabernaemontana Divaricata
Deposited: 2002-05-02 Deposition Author(s): Biswas, S. , Chakrabarti, C. , Dattagupta, J.K.
Proposed amino acid sequence and the 1.63 angstrom x-ray crystal structure of a plant cysteine protease ervatamin b: insight into the structural basis of its stability and substrate specificity.
Biswas, S. , Chakrabarti, C. , Dattagupta, J.K.
Primary Citation of Related Structures: 1IWD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| ERVATAMIN B | A | 215 | Tabernaemontana Divaricata | LPSFVDWRSKGAVNSIKNQKQCGSCWAFSAVAAVESINKIRTGQLISLSEQELVDCDTASHGCNGGWMNNAFQYIITNGGIDTQQNYPYSAVQGSCKPYRLRVVSINGFQRVTRNNESALQSAVASQPVSVTVEAAGAPFQHYSSGIFTGPCGTAQNHGVVIVGYGTQSGKNYWIVRNSWGQNWGNQGYIWMERNVASSAGLCGIAQLPSYPTKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-05-02 Deposition Author(s): Biswas, S. , Chakrabarti, C. , Dattagupta, J.K.