Crystal structure of the induced antibacterial protein from tasar silkworm, antheraea mylitta
PDB DOI: 10.2210/pdb1iiz/pdb
Classification: HYDROLASE Organism(s): Antheraea Mylitta
Deposited: 2001-04-24 Deposition Author(s): Abraham, E.G. , Jain, D. , Nagaraju, J. , Nair, D.T. , Salunke, D.M. , Swaminathan, G.J.
Crystal structure of the induced antibacterial protein from tasar silkworm, antheraea mylitta
Abraham, E.G. , Jain, D. , Nagaraju, J. , Nair, D.T. , Salunke, D.M. , Swaminathan, G.J.
Primary Citation of Related Structures: 1IIZ
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| LYSOZYME | A | 120 | Antheraea Mylitta | KRFTRCGLVNELRKQGFDENLMRDWVCLVENESARYTDKIANVNKNGSRDYGLFQINDKYWCSKGSTPGKDCNVTCSQLLTDDITVASTCAKKIYKRTKFDAWSGWDNHCNHSNPDISSC |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-04-24 Deposition Author(s): Abraham, E.G. , Jain, D. , Nagaraju, J. , Nair, D.T. , Salunke, D.M. , Swaminathan, G.J.