Crystal structure of the n-terminal pdz domain of inad in complex with a norpa c-terminal peptide
PDB DOI: 10.2210/pdb1ihj/pdb
Classification: SIGNALING PROTEIN Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2001-04-19 Deposition Author(s): Kimple, M.E. , Siderovski, D.P. , Sondek, J.
Crystal structure of the n-terminal pdz domain of inad in complex with a norpa c-terminal peptide
Kimple, M.E. , Siderovski, D.P. , Sondek, J.
Primary Citation of Related Structures: 1IHJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
InaD | A | 98 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAGELIHMVTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTFDK |
InaD | B | 98 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MAGELIHMVTLDKTGKKSFGICIVRGEVKDSPNTKTTGIFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTEQAVIDLIKEADFKIELEIQTFDK |
phospholipase C | C | 7 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GKTEFCA |
phospholipase C | D | 7 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GKTEFCA |
Method: X-RAY DIFFRACTION
Deposited Date: 2001-04-19 Deposition Author(s): Kimple, M.E. , Siderovski, D.P. , Sondek, J.