Nmr structure of the complex between a-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor
PDB DOI: 10.2210/pdb1hoy/pdb
Classification: TOXIN Organism(s): Rice Stripe Tenuivirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2000-12-12 Deposition Author(s): Bernini, A. , Bracci, L. , Calamandrei, D. , Ciutti, A. , Di Maro, D. , Lelli, B. , Lozzi, L. , Neri, P. , Niccolai, N. , Scarselli, M. , Spiga, O.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the complex between a-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor
Bernini, A. , Bracci, L. , Calamandrei, D. , Ciutti, A. , Di Maro, D. , Lelli, B. , Lozzi, L. , Neri, P. , Niccolai, N. , Scarselli, M. , Spiga, O.
Primary Citation of Related Structures: 1HOY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
LONG NEUROTOXIN 1 | A | 74 | Rice Stripe Tenuivirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG |
MIMOTOPE OF THE NICOTINIC ACETYLCHOLINE RECEPTOR | B | 14 | Rice Stripe Tenuivirus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | HRYYESSLEPWYPD |
Method: SOLUTION NMR
Deposited Date: 2000-12-12 Deposition Author(s): Bernini, A. , Bracci, L. , Calamandrei, D. , Ciutti, A. , Di Maro, D. , Lelli, B. , Lozzi, L. , Neri, P. , Niccolai, N. , Scarselli, M. , Spiga, O.