The three dimensional structure of nk cell receptor nkp44, a triggering partner in natural cytotoxicity
PDB DOI: 10.2210/pdb1hkf/pdb
Classification: RECEPTOR Organism(s): Homo Sapiens
Deposited: 2003-03-10 Deposition Author(s): Biassoni, R. , Bolognesi, M. , Bordo, D. , Cantoni, C. , Conte, R. , Moretta, A. , Moretta, L. , Ponassi, M. , Spallarossa, A.
The three dimensional structure of nk cell receptor nkp44, a triggering partner in natural cytotoxicity
Biassoni, R. , Bolognesi, M. , Bordo, D. , Cantoni, C. , Conte, R. , Moretta, A. , Moretta, L. , Ponassi, M. , Spallarossa, A.
Primary Citation of Related Structures: 1HKF
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| NK CELL ACTIVATING RECEPTOR | A | 122 | Homo Sapiens | MEGSHHHHHHSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVS |
Method: X-RAY DIFFRACTION
Deposited Date: 2003-03-10 Deposition Author(s): Biassoni, R. , Bolognesi, M. , Bordo, D. , Cantoni, C. , Conte, R. , Moretta, A. , Moretta, L. , Ponassi, M. , Spallarossa, A.