Crystal structure of an engrailed homeodomain-dna complex at 2.8 angstroms resolution: a framework for understanding homeodomain-dna interactions
PDB DOI: 10.2210/pdb1hdd/pdb
Classification: TRANSCRIPTION/DNA Organism(s): Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 1991-09-16 Deposition Author(s): Kissinger, C.R. , Kornberg, T.B. , Liu, B. , Martin-Blanco, E. , Pabo, C.O.
Crystal structure of an engrailed homeodomain-dna complex at 2.8 angstroms resolution: a framework for understanding homeodomain-dna interactions
Kissinger, C.R. , Kornberg, T.B. , Liu, B. , Martin-Blanco, E. , Pabo, C.O.
Primary Citation of Related Structures: 1HDD
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
PROTEIN (ENGRAILED HOMEODOMAIN) | C | 61 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS |
PROTEIN (ENGRAILED HOMEODOMAIN) | D | 61 | Murine Hepatitis Virus , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MDEKRPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS |
Method: X-RAY DIFFRACTION
Deposited Date: 1991-09-16 Deposition Author(s): Kissinger, C.R. , Kornberg, T.B. , Liu, B. , Martin-Blanco, E. , Pabo, C.O.