1H3H
Structural basis for specific recognition of an rxxk-containing slp-76 peptide by the gads c-terminal sh3 domain
PDB DOI: 10.2210/pdb1h3h/pdb
Classification: PROTEIN BINDING Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Lucilia Cuprina
Deposited: 2002-09-03 Deposition Author(s): Berry, D. , Li, S.S. , Liu, Q. , Mcglade, C.J. , Nash, P. , Pawson, T.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structural basis for specific recognition of an rxxk-containing slp-76 peptide by the gads c-terminal sh3 domain
Berry, D. , Li, S.S. , Liu, Q. , Mcglade, C.J. , Nash, P. , Pawson, T.
Primary Citation of Related Structures: 1H3H
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| GRB2-RELATED ADAPTOR PROTEIN 2 | A | 60 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Lucilia Cuprina | GRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR |
| LYMPHOCYTE CYTOSOLIC PROTEIN 2 | B | 11 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) , Lucilia Cuprina | APSIDRSTKPA |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2002-09-03 Deposition Author(s): Berry, D. , Li, S.S. , Liu, Q. , Mcglade, C.J. , Nash, P. , Pawson, T.