Solution structure of the major cherry allergen pru av 1 mutant e45w
PDB DOI: 10.2210/pdb1h2o/pdb
Classification: ALLERGEN Organism(s): Prunus Avium
Deposited: 2002-08-12 Deposition Author(s): Boehm, M. , Lehmann, K. , Nerkamp, J. , Neudecker, P. , Roesch, P. , Scheurer, S. , Schweimer, K. , Sticht, H. , Vieths, S.
Solution structure of the major cherry allergen pru av 1 mutant e45w
Boehm, M. , Lehmann, K. , Nerkamp, J. , Neudecker, P. , Roesch, P. , Scheurer, S. , Schweimer, K. , Sticht, H. , Vieths, S.
Primary Citation of Related Structures: 1H2O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MAJOR ALLERGEN PRU AV 1 | A | 159 | Prunus Avium | GVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILWGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENYSYSYTLIEGDALGDTLEKISYETKLVASPSGGSIIKSTSHYHTKGNVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN |
Method: SOLUTION NMR
Deposited Date: 2002-08-12 Deposition Author(s): Boehm, M. , Lehmann, K. , Nerkamp, J. , Neudecker, P. , Roesch, P. , Scheurer, S. , Schweimer, K. , Sticht, H. , Vieths, S.