Insulin at ph 2: structural analysis of the conditions promoting insulin fibre formation.
PDB DOI: 10.2210/pdb1guj/pdb
Classification: HORMONE Organism(s): Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell)
Deposited: 2002-01-28 Deposition Author(s): Brange, J. , Chance, K. , Dodson, G.G. , Finch, J. , Scott, D.J. , Whittingham, J.L. , Wilson, A.
Insulin at ph 2: structural analysis of the conditions promoting insulin fibre formation.
Brange, J. , Chance, K. , Dodson, G.G. , Finch, J. , Scott, D.J. , Whittingham, J.L. , Wilson, A.
Primary Citation of Related Structures: 1GUJ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
INSULIN | A | 21 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) | GIVEQCCTSICSLYQLENYCN |
INSULIN | C | 21 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) | GIVEQCCTSICSLYQLENYCN |
INSULIN | B | 30 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
INSULIN | D | 30 | Sordaria Macrospora (Strain Atcc Mya-333 / Dsm 997 / K(L3346) / K-Hell) | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
Method: X-RAY DIFFRACTION
Deposited Date: 2002-01-28 Deposition Author(s): Brange, J. , Chance, K. , Dodson, G.G. , Finch, J. , Scott, D.J. , Whittingham, J.L. , Wilson, A.