Nmr structure of the human mad1 transrepression domain sid in complex with mammalian sin3a pah2 domain
PDB DOI: 10.2210/pdb1g1e/pdb
Classification: TRANSCRIPTION Organism(s): Mus Musculus , Synthetic Construct
Deposited: 2000-10-11 Deposition Author(s): Brubaker, K. , Cowley, S.M. , Eisenman, R.N. , Huang, K. , Radhakrishnan, I.
Nmr structure of the human mad1 transrepression domain sid in complex with mammalian sin3a pah2 domain
Brubaker, K. , Cowley, S.M. , Eisenman, R.N. , Huang, K. , Radhakrishnan, I.
Primary Citation of Related Structures: 1G1E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| MAD1 PROTEIN | A | 16 | Mus Musculus , Synthetic Construct | RMNIQMLLEAADYLER |
| SIN3A | B | 89 | Mus Musculus , Synthetic Construct | SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA |
Method: SOLUTION NMR
Deposited Date: 2000-10-11 Deposition Author(s): Brubaker, K. , Cowley, S.M. , Eisenman, R.N. , Huang, K. , Radhakrishnan, I.