PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

1G1E

Nmr structure of the human mad1 transrepression domain sid in complex with mammalian sin3a pah2 domain

PDB DOI: 10.2210/pdb1g1e/pdb

Classification: TRANSCRIPTION
Organism(s): Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)

Deposited: 2000-10-11
Deposition Author(s): Brubaker, K. , Cowley, S.M. , Eisenman, R.N. , Huang, K. , Radhakrishnan, I.

Experimental Data Snapshot

Method: SOLUTION NMR
Resolution: N.A.

1g1e
Literature

Nmr structure of the human mad1 transrepression domain sid in complex with mammalian sin3a pah2 domain

Brubaker, K. , Cowley, S.M. , Eisenman, R.N. , Huang, K. , Radhakrishnan, I.

Primary Citation of Related Structures: 1G1E


Proteins
Molecule Chains Sequence Length Organism Sequence
MAD1 PROTEIN A 16 Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) RMNIQMLLEAADYLER
SIN3A B 89 Enterobacter Aerogenes , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) SLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDA
Experimental Data

Method: SOLUTION NMR

Deposited Date: 2000-10-11
Deposition Author(s): Brubaker, K. , Cowley, S.M. , Eisenman, R.N. , Huang, K. , Radhakrishnan, I.