Nmr structure of the n-sh2 domain of the p85 subunit of pi3-kinase complexed to a doubly phosphorylated peptide derived from polyomavirus middle t antigen
PDB DOI: 10.2210/pdb1fu5/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Rattus Norvegicus , Synthetic Construct
Deposited: 2000-09-14 Deposition Author(s): Guenther, U.L. , Liu, Y. , Schaffhausen, B. , Weber, T.
Method: SOLUTION NMR Resolution: N.A.
Nmr structure of the n-sh2 domain of the p85 subunit of pi3-kinase complexed to a doubly phosphorylated peptide derived from polyomavirus middle t antigen
Guenther, U.L. , Liu, Y. , Schaffhausen, B. , Weber, T.
Primary Citation of Related Structures: 1FU5
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT | A | 111 | Rattus Norvegicus , Synthetic Construct | GMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKSIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKY |
| DOUBLY PHOSPHORYLATED MIDDLE T ANTIGEN | B | 15 | Rattus Norvegicus , Synthetic Construct | EEEYMPMEDLYLDIL |
Method: SOLUTION NMR
Deposited Date: 2000-09-14 Deposition Author(s): Guenther, U.L. , Liu, Y. , Schaffhausen, B. , Weber, T.