Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
PDB DOI: 10.2210/pdb1frh/pdb
Classification: ELECTRON TRANSPORT Organism(s): Azotobacter Vinelandii
Deposited: 1993-09-27 Deposition Author(s): Stout, C.D.
Azotobacter vinelandii ferredoxin i: alteration of individual surface charges and the [4fe-4s] cluster reduction potential
Primary Citation of Related Structures: 1FRH
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FERREDOXIN | A | 106 | Azotobacter Vinelandii | AYVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER |
Method: X-RAY DIFFRACTION
Deposited Date: 1993-09-27 Deposition Author(s): Stout, C.D.