Membrane penetration domain of the minor coat protein g3p of phage fd, nmr, 15 structures
PDB DOI: 10.2210/pdb1fgp/pdb
Classification: VIRAL PROTEIN Organism(s): Enterobacteria Phage Fd
Deposited: 1996-12-10 Deposition Author(s): Holliger, P. , Riechmann, L.
Membrane penetration domain of the minor coat protein g3p of phage fd, nmr, 15 structures
Primary Citation of Related Structures: 1FGP
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| FD GENE 3 PROTEIN | A | 70 | Enterobacteria Phage Fd | ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH |
Method: SOLUTION NMR
Deposited Date: 1996-12-10 Deposition Author(s): Holliger, P. , Riechmann, L.